PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G443700.2.p
Common NameSb01g041690, SORBIDRAFT_01g041690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 260aa    MW: 27831.5 Da    PI: 5.9507
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G443700.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.8e-141965148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          + +WT+eEd  l + v ++G+ +W++I++ +  gR +k+c++rw ++l
  Sobic.001G443700.2.p 19 KSAWTKEEDAVLREQVLLHGPQNWAAISEALA-GRNPKSCRLRWCQHL 65
                          579*****************************.***********9986 PP

2Myb_DNA-binding34.93.7e-1174116347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           ++T+ Ede+++     +G++ W+tIa  ++ gRt++ +k+rw+++
  Sobic.001G443700.2.p  74 PFTPLEDEKIIASYCVFGSK-WATIAGFLP-GRTDNAIKNRWHSV 116
                           79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.9281469IPR017930Myb domain
SuperFamilySSF466898.44E-2818113IPR009057Homeodomain-like
SMARTSM007174.0E-141867IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-181867IPR009057Homeodomain-like
PfamPF002493.0E-131965IPR001005SANT/Myb domain
CDDcd001676.72E-132165No hitNo description
SMARTSM007176.1E-871119IPR001005SANT/Myb domain
PROSITE profilePS5129412.85973121IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.7E-1774117IPR009057Homeodomain-like
CDDcd001679.10E-874117No hitNo description
PfamPF002497.5E-974117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAVPEEAAVG DGRPVATKKS AWTKEEDAVL REQVLLHGPQ NWAAISEALA GRNPKSCRLR  60
WCQHLSPLVD TARPFTPLED EKIIASYCVF GSKWATIAGF LPGRTDNAIK NRWHSVLSKV  120
YQQQQRAAAP IRRLPDGTLV LFPLTPGDVK AFRMDTIPVP RHPPPGIGLS GECLNLFPLV  180
AGDLVRGNNA SEAAAMVVDC STDESLVELR LWPSTNHDGG VQDDESLAEL RLWPSTNHGG  240
GVQGDGAGSS GAQDCLVSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_J4e-29191192101MYB3
3zqc_G4e-29191192101MYB3
3zqc_D4e-29191192101MYB3
3zqc_A4e-29191192101MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468207.10.0hypothetical protein SORBIDRAFT_01g041690
TrEMBLC5WRM80.0C5WRM8_SORBI; Putative uncharacterized protein Sb01g041690
STRINGSb01g041690.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-35myb domain protein 77